PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G2097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 570aa    MW: 62360.9 Da    PI: 6.761
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G2097genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.37e-13408466563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR +A rs qRK ++i+eLe+kv++L++e ++L  +l +l+  +a l+s++
  Gh_A03G2097 408 KRVKRILANRQSAARSKQRKMQYIAELEQKVQTLQTEATTLSAQLTMLQRDSAGLTSQN 466
                  8999*************************************************999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-19404468IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.128406469IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-13408465No hitNo description
SuperFamilySSF579597.74E-12408463No hitNo description
PfamPF001709.0E-11408466IPR004827Basic-leucine zipper domain
CDDcd147032.07E-24409460No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MKMEGSNSIP KPQSNLDIPF SNASQMASPS PSPSSSPSPS PSYMRLSPEN NNSKRPGIPP  60
SHPNNPTASL PYSQQIIGSR PNAQHGAPSH SKSLSQPTFF SLDRLPPWCP PPYRDPPVSS  120
ASDPASNDVS MEERFANSNA RSSLPSPVAG GCNEFRIGES SSLPPRKGHR RSSSDVPLGF  180
STMIQSLPQS IPIGNPGVLD RSVSGRDTSF GVGKPIQLVK RESEWRKDTG SNLEVTGERK  240
SEVDVADDLF NAYMNLENLE TLNSSGTEDR DMDSKASGTK TYGGESSDNE VDSRVHKHPI  300
NIQGMSSGVS SEKREGVKRR AAGDIAPTVR HYRSVSMDSY MGSLQFDEDP PKIPPSGNHG  360
NHHSPGSSGD ANSSKFNFEL GSSEFNESEL KKIMENEKLA EMASVDPKRV KRILANRQSA  420
ARSKQRKMQY IAELEQKVQT LQTEATTLSA QLTMLQRDSA GLTSQNNELK FRLQAMEQQA  480
QLKDALNEAL AAEVQRLKLT AAEFSGEVHL SNCMAQQLSI DHQMLQLQPQ QQQQLNIYQM  540
QQQHQPQQGH DNQSQTQQQN GDASAANESK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1420428ARSKQRKMQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.147020.0boll
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1098686750.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478118.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478119.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478120.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478121.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478123.10.0PREDICTED: uncharacterized protein LOC105793819
RefseqXP_012478124.10.0PREDICTED: uncharacterized protein LOC105793819
TrEMBLA0A0B0P5B40.0A0A0B0P5B4_G
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-119bZIP family protein